PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT13814
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family WRKY
Protein Properties Length: 135aa    MW: 14931.9 Da    PI: 10.58
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT13814genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.99.9e-3456114159
               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               ldDgy+WrKYGqK vk+s fprsYYrCt+++C+vkk+v+r a+d+++v++tYeg Hnh+
  EMT13814  56 LDDGYRWRKYGQKAVKNSAFPRSYYRCTHHTCNVKKQVQRLAKDTSIVVTTYEGVHNHP 114
               59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.0E-3442114IPR003657WRKY domain
SuperFamilySSF1182902.88E-2948115IPR003657WRKY domain
PROSITE profilePS5081128.56451116IPR003657WRKY domain
SMARTSM007747.7E-3956115IPR003657WRKY domain
PfamPF031069.0E-2757114IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 135 aa     Download sequence    Send to blast
MVSGVTGAAA PESGAGSSSG VGREETKGKG SARARGSRKA SRPRFAFQTK SENDVLDDGY  60
RWRKYGQKAV KNSAFPRSYY RCTHHTCNVK KQVQRLAKDT SIVVTTYEGV HNHPCEKLME  120
ALNPILRQLQ FLSQL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-2746113774Probable WRKY transcription factor 4
2lex_A5e-2746113774Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00539DAPTransfer from AT5G41570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8404121e-150DQ840412.1 Hordeum vulgare subsp. vulgare WRKY transcription factor 13 (WRKY13) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006646294.14e-68PREDICTED: probable WRKY transcription factor 56
SwissprotQ9FFS38e-58WRK24_ARATH; Probable WRKY transcription factor 24
TrEMBLR7W8D52e-98R7W8D5_AEGTA; Putative WRKY transcription factor 24
TrEMBLW5AF492e-98W5AF49_WHEAT; Uncharacterized protein
STRINGMLOC_32433.12e-78(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP110038133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41570.14e-57WRKY DNA-binding protein 24